PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s870811g010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family MYB
Protein Properties Length: 316aa    MW: 36210.4 Da    PI: 6.7519
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s870811g010genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.45e-161461148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g W++eEde+l++ ++++G g+W++++r  g+ R++k+c++rw +yl
  PDK_30s870811g010 14 KGLWSPEEDEKLYNHIARFGIGCWSSVPRQAGLERCGKSCRLRWINYL 61
                       678*******************************************97 PP

2Myb_DNA-binding48.22.6e-1567110146
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        rg++T++E++l+  +++ lG++ W+ Ia+ ++ gRt++++k++w++
  PDK_30s870811g010  67 RGNFTQQEEDLITSLHEVLGNR-WSQIAAQLP-GRTDNEIKNFWNS 110
                        89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.5E-25664IPR009057Homeodomain-like
PROSITE profilePS5129423.084965IPR017930Myb domain
SuperFamilySSF466893.44E-2912108IPR009057Homeodomain-like
SMARTSM007175.7E-121363IPR001005SANT/Myb domain
PfamPF002491.2E-131461IPR001005SANT/Myb domain
CDDcd001673.28E-101761No hitNo description
Gene3DG3DSA:1.10.10.602.7E-2565116IPR009057Homeodomain-like
SMARTSM007178.6E-1566114IPR001005SANT/Myb domain
PROSITE profilePS5129417.76166116IPR017930Myb domain
PfamPF002491.1E-1367110IPR001005SANT/Myb domain
CDDcd001671.62E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MGRHPHCTKQ KLRKGLWSPE EDEKLYNHIA RFGIGCWSSV PRQAGLERCG KSCRLRWINY  60
LRPDLKRGNF TQQEEDLITS LHEVLGNRWS QIAAQLPGRT DNEIKNFWNS SLKKMLKQRG  120
IDPITHKPLR ETGAQEERQK PSMKPIFGPF ASFECQAVID RVETGANFYR QFRQTCRPLE  180
QNEFMMNFDC SFTSGPNSVY CDYGEALDNS DSCGIQESLN NGSNWNCNIP AQTSTVLGNE  240
VFNWYSSGIK LESPIRTEFK TYERRLNPCQ GLQHVDSSEE FSSYPTTSRS QDLSDAWFDV  300
SQGELACELN GNFLSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-27121165108B-MYB
1h8a_C4e-271211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008784966.10.0PREDICTED: myb-related protein Hv33-like
SwissprotP200271e-71MYB3_HORVU; Myb-related protein Hv33
TrEMBLM0U2H81e-109M0U2H8_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr9P22190_0011e-109(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23273391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.33e-74myb domain protein 55